PAX7 Peptide (AAP32742)

Data Sheet
 
Sku AAP32742
Old sku AAPP03756
Price $99.00
Name PAX7 Peptide (AAP32742)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100 ug
Gene PAX7
Alias symbols FLJ37460, HUP1, PAX7B, RMS2
Gene id 5081
Description of target PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Swissprot id P23759
Protein accession num NP_002575
Nucleotide accession num NM_002584
Protein size 520 amino acids
Molecular weight 57kDa
Species reactivity Human
Application IHC, WB
Peptide sequence QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
Partner proteins HIRA,UBC,Ubc
Quality control The peptide is characterized by mass spectroscopy
Key reference Tomescu,O., et al., (2004) Lab.Invest.84(8),1060-1070
Description This is a synthetic peptide designed for use in combination with anti-PAX7 antibody (Catalog #: ARP32742_P050) made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com