Sku |
AAP32742 |
Old sku |
AAPP03756 |
Price |
$99.00 |
Name |
PAX7 Peptide (AAP32742) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100 ug |
Gene |
PAX7 |
Alias symbols |
FLJ37460, HUP1, PAX7B, RMS2 |
Gene id |
5081 |
Description of target |
PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown. |
Swissprot id |
P23759 |
Protein accession num |
NP_002575 |
Nucleotide accession num |
NM_002584 |
Protein size |
520 amino acids |
Molecular weight |
57kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT |
Partner proteins |
HIRA,UBC,Ubc |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
Tomescu,O., et al., (2004) Lab.Invest.84(8),1060-1070 |
Description |
This is a synthetic peptide designed for use in combination with anti-PAX7 antibody (Catalog #: ARP32742_P050) made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |