HNF4A Peptide - N-terminal region (AAP31946)

Data Sheet
 
Sku AAP31946
Price $99.00
Name HNF4A Peptide - N-terminal region (AAP31946)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene HNF4A
Alias symbols HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
Gene id 3172
Description of target The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
Swissprot id P41235
Protein accession num NP_000448
Nucleotide accession num NM_000457
Protein size 474 amino acids
Molecular weight 53kDa
Species reactivity Human
Application WB
Peptide sequence MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
Partner proteins CREBBP,ELP3,H3F3A,SMARCA4,COPS5,CREBBP,ESR1,FOXO1,HNF1A,HNF4A,MAPK14,MECR,MED1,MED14,NCOA1,NCOA2,NCOA6,NPPA,NR0B2,NR2C2,NR2F1,NRBF2,NRIP1,PNRC1,PNRC2,PPARGC1A,PPARGC1B,PRKAA2,PROX1,SIRT1,SMAD2,SMAD3,SMAD4,SP1,SREBF2,SUB1,TP53,TRIM24,UBE2I,ZNHIT3,AR,COPS5,CREBBP,CTNNB1,EXT2,FOXO1,GPS2,HDAC3,HDAC4,HNF4A,MAPK1,MAPK3,MED1,MED10,MED14,MED16,MED17,MED21,MED23,MED24,MED7,NCOA1,NCOA2,NCOA6,NCOR2,NPPA,NR0B2,NR1I3,NR2C2,NRIP1,PABPC4,PCBD1,PNRC1,PNRC2,PPARGC1A,PPARGC1B,PRMT1,PROX1,RAD50,SIRT1,SMAD3,SMAD4,SNCG,SP1,SREBF1,SREBF2,STK16,SUB1,TGS1,TP53,UBE2I,VDR,XPO1,ZNHIT3
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-HNF4A Antibody (ARP31946_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.
Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com