| Sku |
AAP31272 |
| Price |
$99.00 |
| Name |
Dr1 Peptide - middle region (AAP31272) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Dr1 |
| Alias symbols |
1700121L09Rik, Dr1l, NC2, NC2beta |
| Gene id |
13486 |
| Description of target |
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Dr1 can bind to DNA on its own. It is a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. |
| Swissprot id |
Q91WV0 |
| Protein accession num |
NP_080382 |
| Nucleotide accession num |
NM_026106 |
| Protein size |
176 amino acids |
| Molecular weight |
19kDa |
| Species reactivity |
Mouse, Human |
| Application |
WB |
| Peptide sequence |
KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Dr1 Antibody (ARP31272_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
