| Sku |
AAP30716 |
| Old sku |
AAPP01373 |
| Price |
$99.00 |
| Name |
HTR2B Peptide - N-terminal region (AAP30716) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
HTR2B |
| Alias symbols |
5-HT(2B), 5-HT2B |
| Gene id |
3357 |
| Description of target |
Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens. |
| Swissprot id |
P41595 |
| Protein accession num |
NP_000858 |
| Nucleotide accession num |
NM_000867 |
| Protein size |
481 amino acids |
| Molecular weight |
54kDa |
| Species reactivity |
Human |
| Application |
IF, WB |
| Peptide sequence |
QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
| Partner proteins |
GNA11,GNAQ |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-HTR2B Antibody(ARP30716_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
