Sku |
AAP30716 |
Old sku |
AAPP01373 |
Price |
$99.00 |
Name |
HTR2B Peptide - N-terminal region (AAP30716) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
HTR2B |
Alias symbols |
5-HT(2B), 5-HT2B |
Gene id |
3357 |
Description of target |
Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens. |
Swissprot id |
P41595 |
Protein accession num |
NP_000858 |
Nucleotide accession num |
NM_000867 |
Protein size |
481 amino acids |
Molecular weight |
54kDa |
Species reactivity |
Human |
Application |
IF, WB |
Peptide sequence |
QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
Partner proteins |
GNA11,GNAQ |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-HTR2B Antibody(ARP30716_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |