| Sku |
AAP30416 |
| Price |
$99.00 |
| Name |
CRK Peptide - C-terminal region (AAP30416) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CRK |
| Alias symbols |
CRKII, p38 |
| Gene id |
1398 |
| Description of target |
This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. |
| Swissprot id |
P46108 |
| Protein accession num |
NP_058431 |
| Nucleotide accession num |
NM_016823 |
| Protein size |
304 amino acids |
| Molecular weight |
34kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
IPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLP |
| Partner proteins |
ZAP70,MAP4K1,ABL1,ABL2,ABL2,PDGFRB,ZAP70,ABL1,ABL2,ARHGAP32,ATXN1,AVIL,BCAR1,BCR,BUB1,CBL,CBLC,CRKL,DAB1,DOCK1,DOCK3,DOK4,DPPA4,EGFR,EPHA3,EPHB3,EPHB6,EPS15,ERBB4,FGFR1,FLT1,FRS2,FYN,GAB1,GRB2,IGF1R,INSR,IRS1,IRS2,IRS4,KDR,KIT,MAP4K1,MAP4K5,MAPK8,NCK1,NED |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CRK Antibody (ARP30416_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
