Sku |
AAP30278 |
Price |
$99.00 |
Name |
BAD Peptide - middle region (AAP30278) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
BAD |
Alias symbols |
BBC2, BCL2L8 |
Gene id |
572 |
Description of target |
The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. |
Swissprot id |
Q92934 |
Protein accession num |
NP_004313 |
Nucleotide accession num |
NM_004322 |
Protein size |
168 amino acids |
Molecular weight |
18kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
GAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGREL |
Partner proteins |
BCL2,BCL2,BCL2,BCL2A1,BCL2L1,BCL2L1,BCL2L2,AKT1,BCL2,BCL2A1,BCL2L1,BCL2L10,BCL2L2,EWSR1,HRK,MAP2K5,MAPK8,MCL1,PAK1,PAK7,PIM1,PIM2,PIM3,PPP1CA,PPP3CA,PRKACA,RAF1,RPS6KA1,RPS6KA2,RPS6KA3,RPS6KA5,S100A10,SFN,SNCA,WASF1,YWHAB,YWHAE,YWHAG,YWHAH,YWHAQ,YWHAZ,AKT |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-BAD Antibody (ARP30278_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |