BAD Peptide - middle region (AAP30278)

Data Sheet
 
Sku AAP30278
Price $99.00
Name BAD Peptide - middle region (AAP30278)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene BAD
Alias symbols BBC2, BCL2L8
Gene id 572
Description of target The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
Swissprot id Q92934
Protein accession num NP_004313
Nucleotide accession num NM_004322
Protein size 168 amino acids
Molecular weight 18kDa
Species reactivity Human
Application WB
Peptide sequence GAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGREL
Partner proteins BCL2,BCL2,BCL2,BCL2A1,BCL2L1,BCL2L1,BCL2L2,AKT1,BCL2,BCL2A1,BCL2L1,BCL2L10,BCL2L2,EWSR1,HRK,MAP2K5,MAPK8,MCL1,PAK1,PAK7,PIM1,PIM2,PIM3,PPP1CA,PPP3CA,PRKACA,RAF1,RPS6KA1,RPS6KA2,RPS6KA3,RPS6KA5,S100A10,SFN,SNCA,WASF1,YWHAB,YWHAE,YWHAG,YWHAH,YWHAQ,YWHAZ,AKT
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-BAD Antibody (ARP30278_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com