SCYTOVIRIN Recombinant Protein (Blood fluke) (OPCA05270)

Catalog No: OPCA05270

Product Info

• Predicted Species Reactivity: Schistosoma mansoni|Scytonema varium
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Schistosoma mansoni (Blood fluke)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA
• Protein Sequence: GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-95 aa
• Tag: N-terminal 6xHis-B2M-tagged
• Reference: A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium. Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R. Biochemistry 42:2578-2584(2003)

Target Info

• Alias Symbols: Scytovirin, SVN
• Protein Name: Scytovirin
• Description of Target: Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.
• Uniprot ID: P86041
• Protein Size (# AA): Recombinant
• Molecular Weight: 23.7 kDa