Catalog No: ARP56538_P050
Price: $0.00
SKU
ARP56538_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SCP2 (ARP56538_P050) antibody
Product Info
ReferenceStanley,W.A., (2007) Arch. Biochem. Biophys. 461 (1), 50-58
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SCP2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
Concentration0.5 mg/ml
Blocking PeptideFor anti-SCP2 (ARP56538_P050) antibody is Catalog # AAP56538 (Previous Catalog # AAPP34135)
Gene SymbolSCP2
Gene Full NameSterol carrier protein 2
Alias SymbolsNLTP, SCOX, SCPX, SCP-2, SCP-X, NSL-TP, SCP-CHI
NCBI Gene Id6342
Protein NameNon-specific lipid-transfer protein
Description of TargetSCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.
Uniprot IDQ6NXF4
Protein Accession #NP_001007099
Nucleotide Accession #NM_001007098
Protein Size (# AA)322
Molecular Weight35kDa
Protein InteractionsTRIP13; UBC; PEX5; MPLKIP; MRRF; SUGP1; MRPS28; TBL2; SRRM2; RAB31; SEPT9; TIMM44; ECI2; SCO2; AGPS; STX7; UBL4A; VDAC3; VDAC2; RRBP1; RBMS1; NDUFA7; IDH3G; HSD17B4; ACAA1; RAB8A; ELAVL1; CACNA1A; ACAA2; EHHADH; CAV1; ACOX1; PITPNA;
  1. What is the species homology for "SCP2 Antibody - middle region (ARP56538_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "SCP2 Antibody - middle region (ARP56538_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SCP2 Antibody - middle region (ARP56538_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SCP2 Antibody - middle region (ARP56538_P050)"?

    This target may also be called "NLTP, SCOX, SCPX, SCP-2, SCP-X, NSL-TP, SCP-CHI" in publications.

  5. What is the shipping cost for "SCP2 Antibody - middle region (ARP56538_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SCP2 Antibody - middle region (ARP56538_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SCP2 Antibody - middle region (ARP56538_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SCP2 Antibody - middle region (ARP56538_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SCP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SCP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SCP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SCP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SCP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SCP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SCP2 Antibody - middle region (ARP56538_P050)
Your Rating
We found other products you might like!