- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-SCN5A (ARP35542_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SCN5A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SCN5A (ARP35542_P050) antibody is Catalog # AAP35542 (Previous Catalog # AAPP06782) |
Sample Type Confirmation | SCN5A is supported by BioGPS gene expression data to be expressed in SW620 |
Subunit | alpha |
Reference | Shah,V.N., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (10), 3592-3597 |
Publications | Askar, S. F. A. et al. Similar arrhythmicity in hypertrophic and fibrotic cardiac cultures caused by distinct substrate-specific mechanisms. Cardiovasc. Res. 97, 171-81 (2013). 22977008 Colussi, C. et al. The histone deacetylase inhibitor suberoylanilide hydroxamic acid reduces cardiac arrhythmias in dystrophic mice. Cardiovasc. Res. 87, 73-82 (2010). 20164117 Costa, A. R. et al. Optical mapping of cryoinjured rat myocardium grafted with mesenchymal stem cells. Am. J. Physiol. Heart Circ. Physiol. 302, H270-7 (2012). 22037193 House, C. D. et al. Voltage-gated Na+ channel SCN5A is a key regulator of a gene transcriptional network that controls colon cancer invasion. Cancer Res. 70, 6957-67 (2010). 20651255 |
Gene Symbol | SCN5A |
---|---|
Gene Full Name | Sodium channel, voltage-gated, type V, alpha subunit |
Alias Symbols | HB1, HB2, HH1, IVF, VF1, HBBD, ICCD, LQT3, SSS1, CDCD2, CMD1E, CMPD2, PFHB1, Nav1.5 |
NCBI Gene Id | 6331 |
Protein Name | Sodium channel protein type 5 subunit alpha |
Description of Target | SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The encoded protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in two transcript variants encoding separate isoforms which differ by a single amino acid. Mutation nomenclature has been assigned with respect to the longer isoform. |
Uniprot ID | Q8IZC9 |
Protein Accession # | NP_000326 |
Nucleotide Accession # | NM_000335 |
Protein Size (# AA) | 2015 |
Molecular Weight | 222kDa |
Protein Interactions | CALM1; CAV3; ALB; Nedd4; WWP2; UBC; SNTG2; NEDD4L; DLG2; INADL; DLG4; RGS3; SNTA1; DLG1; RGS2; SCN5A; SNTB2; SNTB1; DLG3; CBL; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SCN5A Antibody - C-terminal region (ARP35542_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
This target may also be called "HB1, HB2, HH1, IVF, VF1, HBBD, ICCD, LQT3, SSS1, CDCD2, CMD1E, CMPD2, PFHB1, Nav1.5" in publications.
-
What is the shipping cost for "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "222kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SCN5A Antibody - C-terminal region (ARP35542_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SCN5A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SCN5A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SCN5A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SCN5A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SCN5A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SCN5A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.