Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP37699_P050
Price: $0.00
SKU
ARP37699_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SCN3B (ARP37699_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SCN3B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
Concentration0.5 mg/ml
Blocking PeptideFor anti-SCN3B (ARP37699_P050) antibody is Catalog # AAP37699 (Previous Catalog # AAPP09033)
Subunitbeta-3
ReferenceKimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Publications

Ho, C., Zhao, J., Malinowski, S., Chahine, M. & O’Leary, M. E. Differential expression of sodium channel beta subunits in dorsal root ganglion sensory neurons. J. Biol. Chem. 287, 15044-53 (2012). 22408255

Hu, D. et al. A mutation in the beta 3 subunit of the cardiac sodium channel associated with Brugada ECG phenotype. Circ. Cardiovasc. Genet. 2, 270-8 (2009). 20031595

Modulation of microRNA-375 expression alters voltage-gated Na(+) channel properties and exocytosis in insulin-secreting cells. Acta Physiol (Oxf). 213, 882-92 (2015). 25627423

Description
Gene SymbolSCN3B
Gene Full NameSodium channel, voltage-gated, type III, beta subunit
Alias SymbolsSCNB3, ATFB16, BRGDA7, HSA243396
NCBI Gene Id55800
Protein NameSodium channel subunit beta-3
Description of TargetSCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
Uniprot IDQ9NY72
Protein Accession #NP_060870
Nucleotide Accession #NM_018400
Protein Size (# AA)215
Molecular Weight24kDa
Protein InteractionsNFASC;
  1. What is the species homology for "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SCN3B Antibody - N-terminal region (ARP37699_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    This target may also be called "SCNB3, ATFB16, BRGDA7, HSA243396" in publications.

  5. What is the shipping cost for "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SCN3B Antibody - N-terminal region (ARP37699_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SCN3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SCN3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SCN3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SCN3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SCN3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SCN3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SCN3B Antibody - N-terminal region (ARP37699_P050)
Your Rating