Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP91235_P050
Price: $0.00
SKU
ARP91235_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SCN2B (ARP91235_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of Mouse SCN2B
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: TVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKMDG
Concentration0.5 mg/ml
Blocking PeptideFor anti-SCN2B (ARP91235_P050) antibody is Catalog # AAP91235
Gene SymbolSCN2B
Gene Full Namesodium channel, voltage-gated, type II, beta
Alias SymbolsGm183, AI840361, 2810451E09Rik
NCBI Gene Id72821
Protein NameSodium channel subunit beta-2
Description of TargetCrucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier (By similarity).
Uniprot IDQ56A07
Protein Accession #NP_001014761.1
Nucleotide Accession #NM_001014761.2
Protein Size (# AA)215
Molecular Weight24 kDa
  1. What is the species homology for "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "SCN2B Antibody - C-terminal region (ARP91235_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    This target may also be called "Gm183, AI840361, 2810451E09Rik" in publications.

  5. What is the shipping cost for "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SCN2B Antibody - C-terminal region (ARP91235_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SCN2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SCN2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SCN2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SCN2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SCN2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SCN2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SCN2B Antibody - C-terminal region (ARP91235_P050)
Your Rating