SCG5 Antibody - N-terminal region (ARP63847_P050)

Catalog No: ARP63847_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SCG5 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SCG5 (ARP63847_P050) antibody is Catalog # AAP63847

Target Info

• Gene Symbol: SCG5
• Gene Full Name: Secretogranin V (7B2 protein)
• Alias Symbols: 7B2, SgV, P7B2, SGNE1
• NCBI Gene Id: 6447
• Protein Name: Neuroendocrine protein 7B2
• Description of Target: SCG5 acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. SCG5 binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. SCG5 is also required for cleavage of PCSK2 but does not appear to be involved in its folding. SCG5 plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
• Uniprot ID: P05408
• Protein Accession #: NP_001138229
• Nucleotide Accession #: NM_001144757
• Protein Size (# AA): 212
• Molecular Weight: 23kDa
• Protein Interactions: UBQLN1; KHDRBS1; UBQLN4; NR1H2; PCSK2;