- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
SCG5 Antibody - N-terminal region (ARP63847_P050)
Datasheets/Manuals | Printable datasheet for anti-SCG5 (ARP63847_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
Peptide Sequence | Synthetic peptide located within the following region: GPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SCG5 (ARP63847_P050) antibody is Catalog # AAP63847 |
Gene Symbol | SCG5 |
---|---|
Gene Full Name | Secretogranin V (7B2 protein) |
Alias Symbols | 7B2, SgV, P7B2, SGNE1 |
NCBI Gene Id | 6447 |
Protein Name | Neuroendocrine protein 7B2 |
Description of Target | SCG5 acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. SCG5 binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. SCG5 is also required for cleavage of PCSK2 but does not appear to be involved in its folding. SCG5 plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro. |
Uniprot ID | P05408 |
Protein Accession # | NP_001138229 |
Nucleotide Accession # | NM_001144757 |
Protein Size (# AA) | 212 |
Molecular Weight | 23kDa |
Protein Interactions | UBQLN1; KHDRBS1; UBQLN4; NR1H2; PCSK2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SCG5 Antibody - N-terminal region (ARP63847_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
This target may also be called "7B2, SgV, P7B2, SGNE1" in publications.
-
What is the shipping cost for "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "23kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SCG5 Antibody - N-terminal region (ARP63847_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SCG5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SCG5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SCG5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SCG5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SCG5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SCG5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.