Search Antibody, Protein, and ELISA Kit Solutions

SCG2 Antibody - N-terminal region (ARP45473_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP45473_P050-FITC Conjugated

ARP45473_P050-HRP Conjugated

ARP45473_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SCG2
Official Gene Full Name:
Secretogranin II
NCBI Gene Id:
7857
Protein Name:
Secretogranin-2
Swissprot Id:
P13521
Protein Accession #:
NP_003460
Nucleotide Accession #:
NM_003469
Alias Symbols:
CHGC, SN, SgII
Replacement Item:
This antibody may replace item sc-1490 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.
Protein Size (# AA):
617
Molecular Weight:
71kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SCG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SCG2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SCG2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-SCG2 (ARP45473_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ATRIP; TUBB4B; UBQLN4; COPS6; UBC;
Blocking Peptide:
For anti-SCG2 (ARP45473_P050) antibody is Catalog # AAP45473 (Previous Catalog # AAPP26538)
Datasheets/Manuals:
Printable datasheet for anti-SCG2 (ARP45473_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...