SCD2 Antibody - N-terminal region (ARP90756_P050)

Catalog No: ARP90756_P050

Host: Rabbit
Target Name: SCD2
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SCD2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SATTTITAPPSGGQQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQDDEG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SCD2 (ARP90756_P050) antibody is Catalog # AAP90756

Target Info

• Gene Symbol: SCD2
• Gene Full Name: stearoyl-Coenzyme A desaturase 2
• Alias Symbols: Scd-, swty, Scd-2, Mir5114, mir-5114
• NCBI Gene Id: 20250
• Protein Name: Acyl-CoA desaturase 2
• Description of Target: Stearyl-CoA desaturase that utilizes O2 and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides, especially during embryonic development and in neonates. Important for normal permeability barrier function of the skin in neonate.
• Uniprot ID: P13011
• Protein Accession #: NP_033154.2
• Nucleotide Accession #: NM_009128.2
• Protein Size (# AA): 358
• Molecular Weight: 39 kDa