Catalog No: ARP58173_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP58173_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SCAND2P (ARP58173_P050-HRP) antibody
Product Info
Reference0
Predicted Species ReactivityHuman, Horse
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SCAND2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 100%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL
Concentration0.5 mg/ml
Blocking PeptideFor anti-SCAND2P (ARP58173_P050-HRP) antibody is Catalog # AAP58173 (Previous Catalog # AAPP32625)
Gene SymbolSCAND2P
Gene Full NameSCAN domain containing 2 pseudogene
Alias SymbolsSCAND2
NCBI Gene Id54581
Protein NamePutative SCAN domain-containing protein 2
Description of TargetThe SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.
Uniprot IDA8K374
Protein Accession #NP_378666
Nucleotide Accession #NM_033640
Protein Size (# AA)152
Molecular Weight18kDa
Protein InteractionsAPP;
  1. What is the species homology for "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Horse".

  2. How long will it take to receive "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    This target may also be called "SCAND2" in publications.

  5. What is the shipping cost for "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SCAND2P"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SCAND2P"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SCAND2P"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SCAND2P"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SCAND2P"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SCAND2P"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SCAND2 Antibody - middle region : HRP (ARP58173_P050-HRP)
Your Rating
We found other products you might like!