Catalog No: OAAF07734 (Formerly GWB-ASB715)
Size:100 ug
Price: $329.00
SKU
OAAF07734
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
ClonalityPolyclonal
IsotypeIgG
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Thr183.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Peptide SequenceSynthetic peptide located within the following region: DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGM
Concentration1 mg/ml
Target Post-Translational ModificationPhospho Specific
SpecificityPhospho-JNK1/2/3 (T183) Polyclonal Antibody detects endogenous levels of JNK1/2/3 protein only when phosphorylated at T183.
Application InfoWB: 1/500 - 1/2000
IHC: 1/100 - 1/300
IF: 1/200 - 1/1000
ELISA: 1/5000
Gene SymbolMAPK10|MAPK8|MAPK9
Gene Full Namemitogen-activated protein kinase 10|mitogen-activated protein kinase 8|mitogen-activated protein kinase 9
Alias Symbolsc-Jun kinase 2;c-Jun N-terminal kinase 1;c-Jun N-terminal kinase 2;c-Jun N-terminal kinase 3;JNK;JNK1;JNK1A2;JNK2;JNK21B1/2;JNK2A;JNK2ALPHA;JNK2B;JNK2BETA;JNK3;JNK3 alpha protein kinase;JNK3A;JNK-46;JNK-55;Jun kinase;JUN N-terminal kinase;MAP kinase 10;MAP kinase 8;MAP kinase 9;MAP kinase p49 3F12;MAPK 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;p493F12;p54a;p54aSAPK;p54bSAPK;PRKM10;PRKM8;PRKM9;SAPK;SAPK1;SAPK1a;SAPK1b;SAPK1c;stress activated protein kinase beta;stress-activated protein kinase 1;stress-activated protein kinase 1a;stress-activated protein kinase 1b;stress-activated protein kinase 1c;Stress-activated protein kinase JNK1;stress-activated protein kinase JNK2;stress-activated protein kinase JNK3.
NCBI Gene Id5599|5601|5602
Protein NameMitogen-activated protein kinase 10|Mitogen-activated protein kinase 8|Mitogen-activated protein kinase 9
Description of TargetSerine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK8/JNK1. In turn, MAPK8/JNK1 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN, JDP2 and ATF2 and thus regulates AP-1 transcriptional activity. Phosphorylates the replication licensing factor CDT1, inhibiting the interaction between CDT1 and the histone H4 acetylase HBO1 to replication origins. Loss of this interaction abrogates the acetylation required for replication initiation. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including p53/TP53 and Yes-associates protein YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Contributes to the survival of erythroid cells by phosphorylating the antagonist of cell death BAD upon EPO stimulation. Mediates starvation-induced BCL2 phosphorylation, BCL2 dissociation from BECN1, and thus activation of autophagy. Phosphorylates STMN2 and hence regulates microtubule dynamics, controlling neurite elongation in cortical neurons. In the developing brain, through its cytoplasmic activity on STMN2, negatively regulates the rate of exit from multipolar stage and of radial migration from the ventricular zone. Phosphorylates several other substrates including heat shock factor protein 4 (HSF4), the deacetylase SIRT1, ELK1, or the E3 ligase ITCH. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the regulation of the circadian clock (PubMed:22441692). Phosphorylates the heat shock transcription factor HSF1, suppressing HSF1-induced transcriptional activity (PubMed:10747973). Phosphorylates POU5F1, which results in the inhibition of POU5F1's transcriptional activity and enhances its proteosomal degradation (By similarity).|Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK9/JNK2. In turn, MAPK9/JNK2 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. In response to oxidative or ribotoxic stresses, inhibits rRNA synthesis by phosphorylating and inactivating the RNA polymerase 1-specific transcription initiation factor RRN3. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including TP53 and YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Upon T-cell receptor (TCR) stimulation, is activated by CARMA1, BCL10, MAP2K7 and MAP3K7/TAK1 to regulate JUN protein levels. Plays an important role in the osmotic stress-induced epithelial tight-junctions disruption. When activated, promotes beta-catenin/CTNNB1 degradation and inhibits the canonical Wnt signaling pathway. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the regulation of the circadian clock (PubMed:22441692). Phosphorylates POU5F1, which results in the inhibition of POU5F1's transcriptional activity and enhances its proteosomal degradation (By similarity).|Serine/threonine-protein kinase involved in various processes such as neuronal proliferation, differentiation, migration and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK10/JNK3. In turn, MAPK10/JNK3 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. Plays regulatory roles in the signaling pathways during neuronal apoptosis. Phosphorylates the neuronal microtubule regulator STMN2. Acts in the regulation of the amyloid-beta precursor protein/APP signaling during neuronal differentiation by phosphorylating APP. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the photic regulation of the circadian clock (PubMed:22441692).
Uniprot IDP45983|P45984|P53779
Molecular Weight48 kDa
  1. What is the species homology for "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)" provided in?

    This item is provided in "Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    This target may also be called "c-Jun kinase 2;c-Jun N-terminal kinase 1;c-Jun N-terminal kinase 2;c-Jun N-terminal kinase 3;JNK;JNK1;JNK1A2;JNK2;JNK21B1/2;JNK2A;JNK2ALPHA;JNK2B;JNK2BETA;JNK3;JNK3 alpha protein kinase;JNK3A;JNK-46;JNK-55;Jun kinase;JUN N-terminal kinase;MAP kinase 10;MAP kinase 8;MAP kinase 9;MAP kinase p49 3F12;MAPK 9;mitogen-activated protein kinase 10;mitogen-activated protein kinase 8;mitogen-activated protein kinase 9;p493F12;p54a;p54aSAPK;p54bSAPK;PRKM10;PRKM8;PRKM9;SAPK;SAPK1;SAPK1a;SAPK1b;SAPK1c;stress activated protein kinase beta;stress-activated protein kinase 1;stress-activated protein kinase 1a;stress-activated protein kinase 1b;stress-activated protein kinase 1c;Stress-activated protein kinase JNK1;stress-activated protein kinase JNK2;stress-activated protein kinase JNK3." in publications.

  5. What is the shipping cost for "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAPK10|MAPK8|MAPK9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAPK10|MAPK8|MAPK9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAPK10|MAPK8|MAPK9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAPK10|MAPK8|MAPK9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAPK10|MAPK8|MAPK9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAPK10|MAPK8|MAPK9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SAPK/JNK Antibody (Phospho-Thr183) (OAAF07734)
Your Rating
We found other products you might like!