Salivary antigen 1 Recombinant Protein (Cat flea) (OPCA02369)

Catalog No: OPCA02369

Salivary antigen 1 Recombinant Protein (Ctenocephalides felis) (OPCA02369) in SDS-PAGE showing the molecular weight of approximately 34.09 kDa.

Product Info

• Predicted Species Reactivity: Ctenocephalides felis
• Product Format: Liquid or Lyophilized powder
• Host: Ctenocephalides felis
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK
• Protein Sequence: EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 19-176 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Salivary antigens of Ctenocephalides felis: collection, purification and evaluation by intradermal skin testing in dogs.Frank G.R., Hunter S.W., Wallenfels L.J., Kwochka K.
• Alias Symbols: FS-I.
• Protein Name: Salivary antigen 1
• Uniprot ID: Q94424
• Protein Size (# AA): Recombinant
• Molecular Weight: 34.1 kDa