SAA1 Recombinant Protein (Cat) (OPCA01836)

Catalog No: OPCA01836

SAA1 Recombinant Protein (Cat) (OPCA01836) in SDS-PAGE showing the molecular weight of approximately 26.1 kDa.

Product Info

• Predicted Species Reactivity: Cat|Felis catus
• Product Format: Liquid or Lyophilized powder
• Host: Cat
• Additional Information: Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
• Protein Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-90 aa
• Tag: N-terminal 6xHis-B2M-tagged

Target Info

• Reference: Initial sequence and comparative analysis of SAA cat genome.Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. , Yuhki N., Pecon-Slattery J., Johnson W.E., Bourque G., Tesler G., O'Brien S.J.Genome Res. 17:1675-1689(2007)
• Gene Symbol: SAA1
• Alias Symbols: Amyloid fibril protein AACurated
• Protein Name: Serum amyloid A protein
• Description of Target: Major acute phase reactant. Apolipoprotein of the HDL complex.
• Uniprot ID: P19707
• Protein Size (# AA): Recombinant
• Molecular Weight: 24.1 kDa