SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61367_P050
Price: $0.00
SKU
ARP61367_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP61367_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: QYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAPP47484
Gene SymbolS100A8
Gene Full NameS100 calcium binding protein A8
Alias SymbolsP8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG
NCBI Gene Id6279
Protein NameProtein S100-A8
Description of TargetThe protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.
Uniprot IDP05109
Protein Accession #NP_002955
Nucleotide Accession #NM_002964
Protein Size (# AA)93
Molecular Weight10kDa
Protein InteractionsNCF2; TUBGCP3; SUMO2; S100A8; BECN1; BAG3; SRP1; SEC27; CDC34; CDC53; TRAF3IP1; PAXIP1; ESR1; APP; SHC1; COPS5; TFAP4; CDK2; SIRT7; UBC; CDKN1A; POT1; TERF2; TERF1; S100A9; SLX1B; DMWD; PDCD11; LRIF1; CEACAM3; KLC2; RAB17; IGSF21; CHGB; C14orf1; UNC119; P
  1. What is the species homology for "S100A8 Antibody - middle region (ARP61367_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "S100A8 Antibody - middle region (ARP61367_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "S100A8 Antibody - middle region (ARP61367_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "S100A8 Antibody - middle region (ARP61367_P050)"?

    This target may also be called "P8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG" in publications.

  5. What is the shipping cost for "S100A8 Antibody - middle region (ARP61367_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "S100A8 Antibody - middle region (ARP61367_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "S100A8 Antibody - middle region (ARP61367_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "10kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "S100A8 Antibody - middle region (ARP61367_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "S100A8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "S100A8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "S100A8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "S100A8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "S100A8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "S100A8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:S100A8 Antibody - middle region (ARP61367_P050)
Your Rating
We found other products you might like!