$0.00
In Stock
SKU
OPCA181500
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

RUTB Recombinant Protein (Enterobacter cloacae subsp. cloacae) (OPCA181500)

Catalog#: OPCA181500
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Enterobacter cloacae subsp. cloacae
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MTTLNARPEAITFSAPQSALIVVDMQNAYASPGGYLDLAGFDVSATRPVIENIKTAVAAARAAGMLIIWFQNGWDDQYVEAGGPGSPNFHKSNALKTMRKRPELQGKLLAKGGWDYQLVDELVPEAGDIVLPKPRYSGFFNTPLDSLLRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPEFAQKAALFNIETFFGWVSNVADFCDALNPPLARIA
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA181500
Gene Symbol RUTB
NCBI Gene Id 9125109
Swissprot Id D5CE33
Protein Size (# AA) 229
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RUTB.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RUTB.
Write Your Own Review
You're reviewing:RUTB Recombinant Protein (Enterobacter cloacae subsp. cloacae) (OPCA181500)
Your Rating