Search Antibody, Protein, and ELISA Kit Solutions

RUNX3 Antibody - C-terminal region : FITC (ARP74196_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74196_P050 Unconjugated

ARP74196_P050-HRP Conjugated

ARP74196_P050-Biotin Conjugated

Gene Symbol:
RUNX3
NCBI Gene Id:
864
Swissprot Id:
Q13761
Alias Symbols:
RUNX3, AML2, CBFA3, PEBP2A3,
Replacement Item:
This antibody may replace item sc-101553 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
415
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RUNX3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RUNX3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RUNX3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
Dlg4; UBC; PML; PIN1; NOTCH1; RBPJ; SIRT2; Cdk4; MDM2; EZH2; Vdr; SMURF2; SMURF1; HDAC9; SUV39H1; SMAD3; EP300; CBFB; SP110; HDAC5; HDAC4; HDAC2; HDAC1; TLE1; SMAD1; YAP1; SMAD5; SMAD2; PHB2;
Blocking Peptide:
For anti-RUNX3 (ARP74196_P050-FITC) antibody is Catalog # AAP74196
Datasheets/Manuals:
Printable datasheet for anti-RUNX3 (ARP74196_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...