RUBCNL Antibody - middle region (ARP83634_P050)

Catalog No: ARP83634_P050

Host: Rabbit
Target Name: C13ORF18
Sample Tissue: Human RPMI 8226 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C13ORF18
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RUBCNL (ARP83634_P050) antibody is Catalog # AAP83634

Target Info

• Gene Symbol: RUBCNL
• Gene Full Name: RUN and cysteine rich domain containing beclin 1 interacting protein like
• Alias Symbols: PACER, C13orf18, KIAA0226L
• NCBI Gene Id: 80183
• Protein Name: protein RUBCNL-like
• Description of Target: This gene encodes a cysteine-rich protein that contains a putative zinc-RING and/or ribbon domain. The encoded protein is related to Run domain Beclin-1-interacting and cysteine-rich domain-containing protein, which plays a role in endocytic trafficking and autophagy. In cervical cancer cell lines, this gene is expressed at low levels and may function as a tumor suppressor. Promoter hypermethylation of this gene is observed in cervical cancer cell lines and tissue derived from human patients.
• Uniprot ID: Q9H714-6
• Protein Accession #: NP_001273690.1
• Nucleotide Accession #: NM_001286761.1
• Protein Size (# AA): 527
• Molecular Weight: 59 kDa