Search Antibody, Protein, and ELISA Kit Solutions

RTRAF Antibody - N-terminal region (ARP34545_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34545_P050-FITC Conjugated

ARP34545_P050-HRP Conjugated

ARP34545_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
RNA transcription, translation and transport factor
NCBI Gene Id:
Protein Name:
RNA transcription, translation and transport factor protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CLE, CLE7, hCLE, CGI99, RLLM1, hCLE1, CGI-99, LCRP369, C14orf166
Replacement Item:
This antibody may replace item sc-104832, HPA039824
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RTRAF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RTRAF.
The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf166
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
Complete computational species homology data:
Anti-C14orf166 (ARP34545_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RTRAF (ARP34545_P050) antibody is Catalog # AAP34545 (Previous Catalog # AAPP05727)
Printable datasheet for anti-RTRAF (ARP34545_P050) antibody
Sample Type Confirmation:

C14orf166 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Howng,S.L., et al., (2004) FEBS Lett. 566 (1-3), 162-168

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...