Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RTRAF Antibody - N-terminal region (ARP34545_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP34545_P050-FITC Conjugated

ARP34545_P050-HRP Conjugated

ARP34545_P050-Biotin Conjugated

Gene Symbol:
RTRAF
NCBI Gene Id:
51637
Official Gene Full Name:
RNA transcription, translation and transport factor
Protein Name:
RNA transcription, translation and transport factor protein
Swissprot Id:
Q9Y224
Protein Accession #:
NP_057123
Nucleotide Accession #:
NM_016039
Alias Symbols:
CLE, CLE7, hCLE, CGI99, RLLM1, hCLE1, CGI-99, LCRP369, C14orf166
Replacement Item:
This antibody may replace item sc-104832, HPA039824
Protein Size (# AA):
244
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RTRAF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RTRAF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf166
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
Complete computational species homology data:
Anti-C14orf166 (ARP34545_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; FAM98A; HUWE1; UBC; RPA3; RPA2; RPA1; BMI1; rev; KRT18; ILF2; HNRNPU; FLII; FKBP3; DHX9; DDX1; ABCF1; RTCB; RPL26L1; IGF2BP3; SYNCRIP; LRRFIP1; EIF2B2; EIF2B3; YBX3; RFC4; RFC2; PRKDC; NMT1; MRE11A; GLP1R; BAG3; FN1; DAB2; NOTCH1; FAM98B; C2orf49; MC
Blocking Peptide:
For anti-RTRAF (ARP34545_P050) antibody is Catalog # AAP34545 (Previous Catalog # AAPP05727)
Datasheets/Manuals:
Printable datasheet for anti-RTRAF (ARP34545_P050) antibody
Sample Type Confirmation:

C14orf166 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Howng,S.L., et al., (2004) FEBS Lett. 566 (1-3), 162-168

Tell us what you think about this item!

Write A Review
    Please, wait...