SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46813_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP46813_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-RTN4 (ARP46813_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RTN4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Concentration0.5 mg/ml
Blocking PeptideFor anti-RTN4 (ARP46813_P050-Biotin) antibody is Catalog # AAP46813 (Previous Catalog # AAPP27612)
ReferenceHu,F. (2008) J. Neurosci. 28 (5), 1262-1269
Gene SymbolRTN4
Gene Full NameReticulon 4
Alias SymbolsASY, NSP, NOGO, RTN-X, NSP-CL, RTN4-A, RTN4-C, RTN4-B1, RTN4-B2, NI220/250, Nbla00271, Nbla10545
NCBI Gene Id57142
Protein NameReticulon-4
Description of TargetRTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.
Uniprot IDQ7L7Q5
Protein Accession #NP_008939
Nucleotide Accession #NM_007008
Protein Size (# AA)199
Molecular Weight22kDa
Protein InteractionsHUWE1; SYT16; ZFYVE21; RTN4; SNX15; ARL6IP1; SNX1; UBC; RPA3; RPA2; RPA1; vpu; BAIAP2; LAMA4; ATF2; CLN8; TMEM65; S100A16; EPPK1; SNX12; ACAA2; SLC9A3R2; TJP1; HNRNPM; ILF3; IGFBP7; DDB1; SLC25A10; CIRBP; TERF1; POT1; RPS27; NR4A1; HLA-DPB1; RTN3; RTN4IP1
  1. What is the species homology for "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    This target may also be called "ASY, NSP, NOGO, RTN-X, NSP-CL, RTN4-A, RTN4-C, RTN4-B1, RTN4-B2, NI220/250, Nbla00271, Nbla10545" in publications.

  5. What is the shipping cost for "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RTN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RTN4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RTN4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RTN4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RTN4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RTN4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RTN4 Antibody - middle region : Biotin (ARP46813_P050-Biotin)
Your Rating
We found other products you might like!