Search Antibody, Protein, and ELISA Kit Solutions

RTEL1 Antibody - middle region (ARP88361_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
RTEL1
Official Gene Full Name:
regulator of telomere elongation helicase 1
NCBI Gene Id:
51750
Protein Name:
regulator of telomere elongation helicase 1
Swissprot Id:
Q9NZ71-5
Protein Accession #:
NP_001269938.1
Nucleotide Accession #:
NM_001283009.1
Alias Symbols:
NHL, RTEL, DKCA4, DKCB5, PFBMFT3, C20orf41
Description of Target:
This gene encodes a DNA helicase which functions in the stability, protection and elongation of telomeres and interacts with proteins in the shelterin complex known to protect telomeres during DNA replication. Mutations in this gene have been associated with dyskeratosis congenita and Hoyerall-Hreidarsson syndrome. Read-through transcription of this gene into the neighboring downstream gene, which encodes tumor necrosis factor receptor superfamily, member 6b, generates a non-coding transcript. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
545
Molecular Weight:
59 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RTEL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RTEL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RTEL1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: STAAAQQLDPQEHLNQGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RTEL1 (ARP88361_P050) antibody is Catalog # AAP88361
Datasheets/Manuals:
Printable datasheet for anti-RTEL1 (ARP88361_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...