RRP12 Antibody - C-terminal region (ARP66936_P050)

Catalog No: ARP66936_P050

WB Suggested Anti-RRP12 Antibody
Titration: 1.0 ug/ml
Positive Control: 293T Whole CellRRP12 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRP12
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 77%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEGAKGED
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RRP12 (ARP66936_P050) antibody is Catalog # AAP66936
• Sample Type Confirmation:

  RRP12 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Info

• Gene Symbol: RRP12
• Alias Symbols: KIAA0690
• NCBI Gene Id: 23223
• Protein Name: RRP12-like protein
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q5JTH9
• Protein Accession #: NP_055994
• Nucleotide Accession #: NM_015179
• Protein Size (# AA): 1297
• Molecular Weight: 143kDa
• Protein Interactions: UBC; LIN28A; LGR4; TARBP2; EED; RNF2; BMI1; HDAC11; WHSC1; CSNK2A1; VCP; ESR1; RBM28; POLR3F; RPL5; CAND1; COPS5; COPS6; CUL1; CUL3; SIRT7; AP2M1; SUMO2; Csnk1e; Ybx1; DDX56;