RPSM Recombinant Protein (Escherichia coli) (OPCA00769)

Catalog No: OPCA00769

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : GST tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
• Protein Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-118 aa
• Tag: N-terminal GST-tagged

Target Info

• Reference: Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level.Pohl T., Wittmann-Liebold B.J. Biol. Chem. 263:4293-4301(1988)
• Gene Symbol: rpsM
• Gene Full Name: 30S ribosomal subunit protein S13
• Alias Symbols: 30S ribosomal subunit protein S13;b3298;ECK3285;Small ribosomal subunit protein uS13.
• NCBI Gene Id: 947791
• Protein Name: 30S ribosomal protein S13
• Description of Target: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.
• Uniprot ID: P0A7S9
• Protein Size (# AA): Recombinant
• Molecular Weight: 40 kDa