Rpsa Antibody - N-terminal region (ARP54682_P050)

Catalog No: ARP54682_P050

WB Suggested Anti-Rpsa Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Rpsa (ARP54682_P050) antibody is Catalog # AAP54682 (Previous Catalog # AAPP36801)

Target Info

• Gene Symbol: Rpsa
• Gene Full Name: Ribosomal protein SA
• Alias Symbols: L, La, MLR, P40, 67lr, Lamr, P40-, 67kDa, Lamr1, P40-3, P40-8, Lamrl1, AL022858
• NCBI Gene Id: 16785
• Protein Name: 40S ribosomal protein SA
• Description of Target: Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.
• Uniprot ID: P14206
• Protein Accession #: NP_035159
• Nucleotide Accession #: NM_011029
• Protein Size (# AA): 295
• Molecular Weight: 32kDa
• Protein Interactions: Eed; Rara; Rpgrip1l; Tcf3;