RPSA Antibody - middle region (ARP54683_P050)

Catalog No: ARP54683_P050

WB Suggested Anti-RPSA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

WB Suggested Anti-RPSA Antibody Titration: 1 ug/ml
Positive Control: Human Kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPSA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPSA (ARP54683_P050) antibody is Catalog # AAP54683 (Previous Catalog # AAPP36802)
• Reference: Umeda,D., (2008) J. Biol. Chem. 283 (6), 3050-3058

Target Info

• Gene Symbol: RPSA
• Gene Full Name: Ribosomal protein SA
• Alias Symbols: SA, LBP, LRP, p40, 67LR, ICAS, lamR, 37LRP, LAMBR, LAMR1, LRP/LR, LBP/p40, NEM/1CHD4
• NCBI Gene Id: 3921
• Protein Name: 40S ribosomal protein SA
• Description of Target: RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis. RPSA also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria.Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: P08865
• Protein Accession #: NP_002286
• Nucleotide Accession #: NM_002295
• Protein Size (# AA): 295
• Molecular Weight: 33kDa
• Protein Interactions: UBC; SUMO2; MDM2; ZBTB1; RNF2; SUP35; rev; SYNCRIP; GNB2L1; DYNLL1; RPS28; RPS23; RPS21; RPS20; RPS18; RPS16; RPS13; RPS12; RPS9; RPS8; RPS5; RPS4X; RPS3A; RPS3; FAU; DYNC1LI2; PTBP1; PRUNE2; TSR1; XRCC6; HNRNPD; TARDBP; UBD; BAG3; PROS1; NKX3-1; ITGA4; I