Catalog No: ARP54683_P050
Price: $0.00
SKU
ARP54683_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RPSA Antibody - middle region (ARP54683_P050)

Datasheets/ManualsPrintable datasheet for anti-RPSA (ARP54683_P050) antibody
Product Info
ReferenceUmeda,D., (2008) J. Biol. Chem. 283 (6), 3050-3058
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RPSA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY
Concentration0.5 mg/ml
Blocking PeptideFor anti-RPSA (ARP54683_P050) antibody is Catalog # AAP54683 (Previous Catalog # AAPP36802)
Gene SymbolRPSA
Gene Full NameRibosomal protein SA
Alias SymbolsSA, LBP, LRP, p40, 67LR, ICAS, lamR, 37LRP, LAMBR, LAMR1, LRP/LR, LBP/p40, NEM/1CHD4
NCBI Gene Id3921
Protein Name40S ribosomal protein SA
Description of TargetRPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis. RPSA also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria.Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Uniprot IDP08865
Protein Accession #NP_002286
Nucleotide Accession #NM_002295
Protein Size (# AA)295
Molecular Weight33kDa
Protein InteractionsUBC; SUMO2; MDM2; ZBTB1; RNF2; SUP35; rev; SYNCRIP; GNB2L1; DYNLL1; RPS28; RPS23; RPS21; RPS20; RPS18; RPS16; RPS13; RPS12; RPS9; RPS8; RPS5; RPS4X; RPS3A; RPS3; FAU; DYNC1LI2; PTBP1; PRUNE2; TSR1; XRCC6; HNRNPD; TARDBP; UBD; BAG3; PROS1; NKX3-1; ITGA4; I
  1. What is the species homology for "RPSA Antibody - middle region (ARP54683_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "RPSA Antibody - middle region (ARP54683_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPSA Antibody - middle region (ARP54683_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPSA Antibody - middle region (ARP54683_P050)"?

    This target may also be called "SA, LBP, LRP, p40, 67LR, ICAS, lamR, 37LRP, LAMBR, LAMR1, LRP/LR, LBP/p40, NEM/1CHD4" in publications.

  5. What is the shipping cost for "RPSA Antibody - middle region (ARP54683_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPSA Antibody - middle region (ARP54683_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPSA Antibody - middle region (ARP54683_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPSA Antibody - middle region (ARP54683_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RPSA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPSA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPSA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPSA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPSA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPSA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPSA Antibody - middle region (ARP54683_P050)
Your Rating
We found other products you might like!