SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP89908_P050
Price: $0.00
SKU
ARP89908_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RPSA (ARP89908_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse RPSA
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: TAPAPEFTAAQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPT
Concentration0.5 mg/ml
Blocking PeptideFor anti-RPSA (ARP89908_P050) antibody is Catalog # AAP89908
Gene SymbolRPSA
Gene Full Nameribosomal protein SA
Alias SymbolsL, La, MLR, P40, 67lr, Lamr, P40-, 67kDa, Lamr1, P40-3, P40-8, Lamrl1, AL022858
NCBI Gene Id16785
Protein NameMLR, P40, 67lr, Lamr, 67kDa, Lamr1, P40-3, P40-8, Lamrl1, AL022858
Description of TargetRequired for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. Acts as a PPP1R16B-dependent substrate of PPP1CA (By similarity). Enables malignant tumor cells to penetrate laminin tissue and vessel barriers. Activates precursor thymic anti-OFA/iLRP specific cytotoxic T-cell. May induce CD8 T-suppressor cells secreting IL-10.
Uniprot IDP14206
Protein Accession #NP_035159.3
Nucleotide Accession #NM_011029.4
Protein Size (# AA)295
Molecular Weight32 kDa
  1. What is the species homology for "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "RPSA Antibody - C-terminal region (ARP89908_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    This target may also be called "L, La, MLR, P40, 67lr, Lamr, P40-, 67kDa, Lamr1, P40-3, P40-8, Lamrl1, AL022858" in publications.

  5. What is the shipping cost for "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPSA Antibody - C-terminal region (ARP89908_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RPSA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPSA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPSA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPSA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPSA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPSA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPSA Antibody - C-terminal region (ARP89908_P050)
Your Rating