Catalog No: ARP56147_P050-FITC
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-RPS7 (ARP56147_P050-FITC) antibody
Product Info
ReferenceChen,D., (2007) Oncogene 26 (35), 5029-5037
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC: Fluorescein Isothiocyanate
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RPS7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE
Concentration0.5 mg/ml
Blocking PeptideFor anti-RPS7 (ARP56147_P050-FITC) antibody is Catalog # AAP56147 (Previous Catalog # AAPP37920)
Gene SymbolRPS7
Gene Full NameRibosomal protein S7
Alias SymbolsS7, eS7, DBA8
NCBI Gene Id6201
Protein Name40S ribosomal protein S7
Description of TargetRPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP62081
Protein Accession #NP_001002
Nucleotide Accession #NM_001011
Protein Size (# AA)194
Molecular Weight22kDa
Protein InteractionsRPS3; MDM2; HUWE1; ZBTB14; UBC; TP53; CEP76; TUBGCP3; CEP57; CDC37L1; RPA3; RPA2; RPA1; RNF2; EED; FAU; DDX3X; PSMC4; WIBG; EIF2A; WDR26; PNO1; TSR1; RPS27L; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13
  1. What is the species homology for "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Pig, Rabbit".

  2. How long will it take to receive "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    This target may also be called "S7, eS7, DBA8" in publications.

  5. What is the shipping cost for "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RPS7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPS7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPS7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPS7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPS7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPS7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPS7 Antibody - N-terminal region : FITC (ARP56147_P050-FITC)
Your Rating
We found other products you might like!