RPS6KB1 Antibody - middle region (ARP90038_P050)

Catalog No: ARP90038_P050

Host: Rabbit
Target Name: RPS6KB1
Sample Tissue: Mouse SP2/0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse RPS6KB1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPS6KB1 (ARP90038_P050) antibody is Catalog # AAP90038

Target Info

• Gene Symbol: RPS6KB1
• Gene Full Name: ribosomal protein S6 kinase, polypeptide 1
• Alias Symbols: S6K, S6K1, p70s, p70S6, p70s6k, P70S6K1, p70/85s, AA959758, AI256796, AI314060, p70 S6KA, p70-S6K 1, p70/85s6k, S6K-beta-1, 2610318I15Rik, p70 S6K-alpha
• NCBI Gene Id: 72508
• Protein Name: ribosomal protein S6 kinase beta-1
• Description of Target: phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex. Upon mitogenic stimulation, phosphorylation by the mammalian target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation. The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B. Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis. Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR. In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2. Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling. Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function. Phosphorylates mitochondrial RMP leading to dissociation of a RMP:PPP1CC complex. The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. May be involved in cytoskeletal rearrangement through binding to neurabin. Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR (By similarity). Following activation by mTORC1, phosphorylates EPRS and thereby plays a key role in fatty acid uptake by adipocytes and also most probably in interferon-gamma-induced translation inhibition).
• Uniprot ID: Q8BSK8
• Protein Accession #: NP_001107806.1
• Nucleotide Accession #: NM_001114334.1
• Protein Size (# AA): 525
• Molecular Weight: 57 kDa