SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63572_P050
Price: $0.00
SKU
ARP63572_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RPS2 (ARP63572_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityRat, Dog, Pig, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Pig: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVA
Concentration0.5 mg/ml
Blocking PeptideFor anti-RPS2 (ARP63572_P050) antibody is Catalog # AAP63572
Sample Type Confirmation

RPS2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Publications

Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis. Plant Cell. 25, 1523-40 (2013). 23667124

Deletion of the N-Terminal Domain of Yeast Eukaryotic Initiation Factor 4B Reprograms Translation and Reduces Growth in Urea. Front Mol Biosci. 8, 787781 (2022). 35047555

Zfrp8/PDCD2 Interacts with RpS2 Connecting Ribosome Maturation and Gene-Specific Translation. PLoS ONE. 11, e0147631 (2016). 26807849

Description
Gene SymbolRPS2
Gene Full NameRibosomal protein S2
Alias SymbolsS2, LLREP3
NCBI Gene Id6187
Protein Name40S ribosomal protein S2
Description of TargetRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Uniprot IDP15880
Protein Accession #NP_002943
Nucleotide Accession #NM_002952
Protein Size (# AA)293
Molecular Weight32kDa
Protein InteractionsUBC; TP53; CEP250; TUBGCP3; TUBG1; NEDD1; STAU1; MDM2; RNF2; rev; RPS29; RPS28; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS18; RPS16; RPS15A; DYNLL1; EIF3CL; WIBG; TSR1; SND1; RPS15; RPS14; RPS13; RPS12; RPS11; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5
  1. What is the species homology for "RPS2 Antibody - middle region (ARP63572_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Rat, Dog, Pig, Yeast, Zebrafish".

  2. How long will it take to receive "RPS2 Antibody - middle region (ARP63572_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPS2 Antibody - middle region (ARP63572_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPS2 Antibody - middle region (ARP63572_P050)"?

    This target may also be called "S2, LLREP3" in publications.

  5. What is the shipping cost for "RPS2 Antibody - middle region (ARP63572_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPS2 Antibody - middle region (ARP63572_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPS2 Antibody - middle region (ARP63572_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPS2 Antibody - middle region (ARP63572_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RPS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPS2 Antibody - middle region (ARP63572_P050)
Your Rating
We found other products you might like!