Size:100 ul
$289.00
In Stock
SKU
ARP74191_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74191_P050 Unconjugated

ARP74191_P050-HRP Conjugated

ARP74191_P050-Biotin Conjugated

RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)

Catalog#: ARP74191_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RS19
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH
Concentration 0.5 mg/ml
Blocking Peptide For anti-RPS19 (ARP74191_P050-FITC) antibody is Catalog # AAP74191
Datasheets/Manuals Printable datasheet for anti-RPS19 (ARP74191_P050-FITC) antibody
Gene Symbol RPS19
Official Gene Full Name ribosomal protein S19
Alias Symbols DBA, S19, DBA1, eS19
NCBI Gene Id 6223
Protein Name 40S ribosomal protein S19
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Swissprot Id P39019
Protein Accession # NP_001013
Protein Size (# AA) 145
Molecular Weight 15kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RPS19.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RPS19.
Protein Interactions TP53; HUWE1; CEP250; NEDD1; TUBGCP4; TUBGCP2; PPP2R1A; AURKA; UBC; MDM2; RPS17; RNF2; WIBG; EIF2A; TSR1; SERBP1; EIF3E; FAU; RPS29; RPS28; RPS26; RPS25; RPS24; RPS23; RPS20; RPS18; RPS16; RPS15A; RPS15; RPS14; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6;
  1. What is the species homology for "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    This target may also be called "DBA, S19, DBA1, eS19" in publications.

  5. What is the shipping cost for "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RPS19"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPS19"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPS19"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPS19"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPS19"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPS19"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)
Your Rating
We found other products you might like!