Search Antibody, Protein, and ELISA Kit Solutions

RPS19 Antibody - C-terminal region : FITC (ARP74191_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74191_P050 Unconjugated

ARP74191_P050-HRP Conjugated

ARP74191_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
RPS19
Official Gene Full Name:
ribosomal protein S19
NCBI Gene Id:
6223
Protein Name:
40S ribosomal protein S19
Swissprot Id:
P39019
Protein Accession #:
NP_001013
Alias Symbols:
DBA, S19, DBA1, eS19
Description of Target:
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Protein Size (# AA):
145
Molecular Weight:
15kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPS19.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPS19.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RS19
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
TP53; HUWE1; CEP250; NEDD1; TUBGCP4; TUBGCP2; PPP2R1A; AURKA; UBC; MDM2; RPS17; RNF2; WIBG; EIF2A; TSR1; SERBP1; EIF3E; FAU; RPS29; RPS28; RPS26; RPS25; RPS24; RPS23; RPS20; RPS18; RPS16; RPS15A; RPS15; RPS14; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6;
Blocking Peptide:
For anti-RPS19 (ARP74191_P050-FITC) antibody is Catalog # AAP74191
Datasheets/Manuals:
Printable datasheet for anti-RPS19 (ARP74191_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...