RPS15 Antibody - middle region (ARP56185_P050)

Catalog No: ARP56185_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: RPS15
Sample Tissue: Human Hela
Antibody Dilution: 1.0ug/ml

Product Info

• Publications:

  Assessing the translational landscape of myogenic differentiation by ribosome profiling. Nucleic Acids Res. 43, 4408-28 (2015). 25873627

  More...

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS15
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPS15 (ARP56185_P050) antibody is Catalog # AAP56185 (Previous Catalog # AAPP38108)

Target Info

• Reference: Yu,Y., (2005) Protein Sci. 14 (6), 1438-1446
• Gene Symbol: RPS15
• Gene Full Name: Ribosomal protein S15
• Alias Symbols: RIG, S15
• NCBI Gene Id: 6209
• Protein Name: 40S ribosomal protein S15
• Description of Target: The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19P family of ribosomal proteins. It is located in the cytoplasm. This gene has been found to be activated in various tumors, such as insulinomas, esophageal cancers, and colon cancers. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P62841
• Protein Accession #: NP_001009
• Nucleotide Accession #: NM_001018
• Protein Size (# AA): 145
• Molecular Weight: 17kDa
• Protein Interactions: G2E3; UBC; CEP76; TUBGCP3; TUBG1; TP53; RPS17; RNF2; RPS2; RPS29; RPS25; RPS19; RPS10; RPS9; MDM4; MDM2; ICAM1; CD81; IGSF8; PLA2G12A; SERINC3; RAPGEF1; FN1; SMURF1; ATP6V0A1; ELAVL1; STT3B; MRPL24; PTRH2; ATP6V1D; MRPL2; RPL36; ATP6V0A2; MRPL3; TCIRG1; F