RPRD1A Antibody - middle region (ARP83113_P050)

Catalog No: ARP83113_P050

Host: Rabbit
Target Name: RPRD1A
Sample Tissue: Human RPMI 8226 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPRD1A
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDEN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPRD1A (ARP83113_P050) antibody is Catalog # AAP83113

Target Info

• Gene Symbol: RPRD1A
• Gene Full Name: regulation of nuclear pre-mRNA domain containing 1A
• Alias Symbols: P15RS, HsT3101
• NCBI Gene Id: 55197
• Protein Name: regulation of nuclear pre-mRNA domain-containing protein 1A
• Description of Target: This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16.
• Uniprot ID: Q96P16-3
• Protein Accession #: NP_060640.2
• Nucleotide Accession #: NM_001303411.1
• Protein Size (# AA): 276
• Molecular Weight: 30 kDa