Catalog No: OPCA158965
Price: $0.00
SKU
OPCA158965
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ RPLY Recombinant Protein (Methylocella silvestris) (OPCA158965)
Datasheets/Manuals | Printable datasheet for OPCA158965 |
---|
Predicted Species Reactivity | Methylocella silvestris |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MAETKTLAAAARHGTGKGAARSVRREGRIPGVIYGGGDPAEPITLDYRELNKLIYAGHFLTTLFEIDVAGTKQRVIPRDYQLDPIKDLPLHVDFLRLKPGASLKVEVPVHFLNQETCPGVKKGGSVNIVRHSIELRVPADDIPEAITADLGELEINDSLHLTALALPQGCRPTQRERDFTIVTITPPLVVAETPVAAAAAAAAPKGKAGAKAAPAAAAAPAAPAKKK |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 1-227 |
Uniprot ID | B8EK41 |
---|---|
Protein Size (# AA) | 227 |
Write Your Own Review