Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP40221_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40221_P050-FITC Conjugated

ARP40221_P050-HRP Conjugated

ARP40221_P050-Biotin Conjugated

RPLP0 Antibody - N-terminal region (ARP40221_P050)

Catalog#: ARP40221_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RPLP0
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-RPLP0 (ARP40221_P050)
Peptide Sequence Synthetic peptide located within the following region: TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-RPLP0 (ARP40221_P050) antibody is Catalog # AAP40221 (Previous Catalog # AAPP22065)
Datasheets/Manuals Printable datasheet for anti-RPLP0 (ARP40221_P050) antibody
Sample Type Confirmation

RPLP0 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Rinne,T., (2008) Hum. Mol. Genet. 17 (13), 1968-1977
Gene Symbol RPLP0
Official Gene Full Name Ribosomal protein, large, P0
Alias Symbols L10E, MGC111226, MGC88175, P0, PRLP0, RPP0, LP0
NCBI Gene Id 6175
Protein Name 60S acidic ribosomal protein P0
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Swissprot Id P05388
Protein Accession # NP_000993
Nucleotide Accession # NM_001002
Protein Size (# AA) 317
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RPLP0.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RPLP0.
Protein Interactions HUWE1; CCNDBP1; UBC; TP53; HAUS2; CEP250; TUBG1; AURKA; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ERG; ZBTB1; PRPF40A; RPL36; FARSB; EEF1E1; AIMP1; LRRFIP1; IQGAP1; GAS7; RPLP1; RPL24; RPL23A; RPL21; RPL19; RPL18; RPL15; RPL13; RPL7A; MARS; IARS; DNAJA1; FAR
  1. What is the species homology for "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPLP0 Antibody - N-terminal region (ARP40221_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    This target may also be called "L10E, MGC111226, MGC88175, P0, PRLP0, RPP0, LP0" in publications.

  5. What is the shipping cost for "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPLP0 Antibody - N-terminal region (ARP40221_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RPLP0"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPLP0"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPLP0"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPLP0"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPLP0"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPLP0"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPLP0 Antibody - N-terminal region (ARP40221_P050)
Your Rating
We found other products you might like!