$0.00
In Stock
SKU
OPCA263774
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

RPLC Recombinant Protein (Pseudomonas mallei) (OPCA263774)

Catalog#: OPCA263774
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Pseudomonas mallei
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MSLGLVGRKVGMTRIFTAEGDSIPVTVLDVSDNRVTQIKTVETDGYTAVQVAFGSRRASRVTKPLAGHLAKAGVEAGEILKEFRIEADKAAELSNGAVIGPDLFEVGQKVDVQGVSIGKGYAGTIKRYNFGSGRASHGNSRSHNVPGSIGMAQDPGRVFPGKRMTGHMGDETVTVQNLEIARIDADRKLLLVKGAVPGAKGGKVFVTPAVKTRAVKGAK
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA263774
Gene Symbol RPLC
NCBI Gene Id 3090400
Swissprot Id Q62GK5
Protein Size (# AA) 219
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RPLC.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RPLC.
Write Your Own Review
You're reviewing:RPLC Recombinant Protein (Pseudomonas mallei) (OPCA263774)
Your Rating