Search Antibody, Protein, and ELISA Kit Solutions

RPL7A Antibody - C-terminal region (ARP61726_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61726_P050-FITC Conjugated

ARP61726_P050-HRP Conjugated

ARP61726_P050-Biotin Conjugated

Gene Symbol:
RPL7A
Official Gene Full Name:
ribosomal protein L7a
NCBI Gene Id:
6130
Protein Name:
60S ribosomal protein L7a
Swissprot Id:
P62424
Protein Accession #:
NP_000963
Nucleotide Accession #:
NM_000972
Alias Symbols:
L7A, TRUP, SURF3
Replacement Item:
This antibody may replace item sc-173910 from Santa Cruz Biotechnology.
Description of Target:
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L7AE family of ribosomal proteins. It can interact with a subclass of nuclear hormone receptors, including thyroid hormone receptor, and inhibit their ability to transactivate by preventing their binding to their DNA response elements. This gene is included in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. It is co-transcribed with the U24, U36a, U36b, and U36c small nucleolar RNA genes, which are located in its second, fifth, fourth, and sixth introns, respectively. This gene rearranges with the trk proto-oncogene to form the chimeric oncogene trk-2h, which encodes an oncoprotein consisting of the N terminus of ribosomal protein L7a fused to the receptor tyrosine kinase domain of trk. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Protein Size (# AA):
266
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPL7A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPL7A.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-RPL7A (ARP61726_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; UBC; TP53; SUMO2; CEP250; STAU1; MDM2; EED; RNF2; EEF1E1; AIMP1; DARS; RPL36; RPLP0; RPL26; RPL23A; RPL21; RPL15; RPL13; QARS; EIF2S1; TRAP1; PARK2; FBXO6; TARDBP; IGSF8; ICAM1; PAN2; SOCS3; UBL4A; VCAM1; ITGA4; FN1; CTBP2; MAGOH; EIF4A3; UPF1; ESR
Blocking Peptide:
For anti-RPL7A (ARP61726_P050) antibody is Catalog # AAP61726 (Previous Catalog # AAPP47916)
Datasheets/Manuals:
Printable datasheet for anti-RPL7A (ARP61726_P050) antibody
Sample Type Confirmation:

RPL7A is supported by BioGPS gene expression data to be expressed in HEK293T

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...