SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61616_P050
Price: $0.00
SKU
ARP61616_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RPL7 (ARP61616_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTE
Concentration0.5 mg/ml
Blocking PeptideFor anti-RPL7 (ARP61616_P050) antibody is Catalog # AAP61616
Sample Type Confirmation

There is BioGPS gene expression data showing that RPL7 is expressed in NCIH226

Gene SymbolRPL7
Gene Full Nameribosomal protein L7
Alias SymbolsL7, humL7-1
NCBI Gene Id6129
Protein Name60S ribosomal protein L7
Description of TargetRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30P family of ribosomal proteins. It contains an N-terminal basic region-leucine zipper (BZIP)-like domain and the RNP consensus submotif RNP2. In vitro the BZIP-like domain mediates homodimerization and stable binding to DNA and RNA, with a preference for 28S rRNA and mRNA. The protein can inhibit cell-free translation of mRNAs, suggesting that it plays a regulatory role in the translation apparatus. It is located in the cytoplasm. The protein has been shown to be an autoantigen in patients with systemic autoimmune diseases, such as systemic lupus erythematosus. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Uniprot IDP18124
Protein Accession #NP_000962
Nucleotide Accession #NM_000971
Protein Size (# AA)248
Molecular Weight29kDa
Protein InteractionsUBC; SUMO2; TUBGCP4; CEP250; TUBG1; TP53; STAU1; MDM2; LGR4; RPA3; RPA2; RPA1; RNF2; EED; PARK2; TARDBP; YWHAQ; PAN2; PHB; HSP90AB1; HSP90AA1; NOS2; IPO5; IL7R; FN1; ESR1; VCAM1; UBL4A; RAN; TRAF3IP1; EIF4A3; PPP1CC; MAGOH; HSP90AA5P; RPLP0P6; RPL10L; NIF
  1. What is the species homology for "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPL7 Antibody - N-terminal region (ARP61616_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    This target may also be called "L7, humL7-1" in publications.

  5. What is the shipping cost for "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPL7 Antibody - N-terminal region (ARP61616_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RPL7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPL7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPL7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPL7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPL7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPL7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPL7 Antibody - N-terminal region (ARP61616_P050)
Your Rating
We found other products you might like!