SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56125_P050
Price: $0.00
SKU
ARP56125_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RPL5 (ARP56125_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse-ear cress
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RPL5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP
Concentration0.5 mg/ml
Blocking PeptideFor anti-RPL5 (ARP56125_P050) antibody is Catalog # AAP56125 (Previous Catalog # AAPP37746)
ReferenceSun,X.X., (2007) J. Biol. Chem. 282 (11), 8052-8059
Gene SymbolRPL5
Gene Full Nameribosomal protein L5
Alias SymbolsL5, uL18, MSTP030, PPP1R135
NCBI Gene Id6125
Protein Name60S ribosomal protein L5
Description of TargetRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome.
Uniprot IDP46777
Protein Accession #NP_000960
Nucleotide Accession #NM_000969
Protein Size (# AA)297
Molecular Weight34kDa
Protein InteractionsHUWE1; UBC; PML; HAUS2; CEP250; TUBG1; TP53; SUMO2; SUMO3; STAU1; LGR4; VHL; RPL5; FBXO6; UPF2; TARDBP; IGSF8; ICAM1; CD81; PAN2; UBL4A; NOS2; VCAM1; MDM2; ITGA4; HSP90AB1; HSP90AA1; FN1; CSNK2A1; RPS3; RPL11; NPM1; ESR1; CBX5; EEF2; EEF1G; EEF1A1; DHX9;
  1. What is the species homology for "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    The tested species reactivity for this item is "Human, Mouse-ear cress". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RPL5 Antibody - N-terminal region (ARP56125_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    This target may also be called "L5, uL18, MSTP030, PPP1R135" in publications.

  5. What is the shipping cost for "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RPL5 Antibody - N-terminal region (ARP56125_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RPL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RPL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RPL5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RPL5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RPL5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RPL5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RPL5 Antibody - N-terminal region (ARP56125_P050)
Your Rating
We found other products you might like!