Search Antibody, Protein, and ELISA Kit Solutions

RPL27A Antibody - N-terminal region (ARP65488_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65488_P050-FITC Conjugated

ARP65488_P050-HRP Conjugated

ARP65488_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RPL27A
NCBI Gene Id:
6157
Swissprot Id:
P46776
Protein Accession #:
NP_000981
Alias Symbols:
RPL27A,
Description of Target:
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L15P family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, multiple processed pseudogenes derived from this gene are dispersed through the genome.
Protein Size (# AA):
148
Molecular Weight:
16kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPL27A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPL27A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPL27A
Peptide Sequence:
Synthetic peptide located within the following region: RGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; UBC; SIAH1; MDM2; ZBTB1; EED; RNF2; EIF2S1; AIMP2; QARS; MARS; HNRNPA2B1; HNRNPA1; EEF1E1; AIMP1; RANBP3; DHX9; DARS; ABCF1; CCAR2; PARP1; GTF2F2; AGO2; UBD; PRKACB; ICAM1; CD81; IGSF8; PAN2; UBL4A; VCAM1; PEX6; ITGA4; FN1; EIF4A3; MAGOH; ESR1; RPL
Blocking Peptide:
For anti-RPL27A (ARP65488_P050) antibody is Catalog # AAP65488
Datasheets/Manuals:
Printable datasheet for anti-RPL27A (ARP65488_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...