Search Antibody, Protein, and ELISA Kit Solutions

RPL18 Antibody - N-terminal region (ARP56127_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56127_P050-FITC Conjugated

ARP56127_P050-HRP Conjugated

ARP56127_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-131061 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human RPL18
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-RPL18 (ARP56127_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RPL18 (ARP56127_P050) antibody is Catalog # AAP56127 (Previous Catalog # AAPP37748)
Printable datasheet for anti-RPL18 (ARP56127_P050) antibody
Sample Type Confirmation:

RPL18 is supported by BioGPS gene expression data to be expressed in HT1080

Target Reference:
Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292
Gene Symbol:
Official Gene Full Name:
Ribosomal protein L18
Alias Symbols:
NCBI Gene Id:
Protein Name:
60S ribosomal protein L18
Description of Target:
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPL18.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPL18.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...