Search Antibody, Protein, and ELISA Kit Solutions

RPL18 Antibody - C-terminal region : FITC (ARP56128_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56128_P050 Unconjugated

ARP56128_P050-HRP Conjugated

ARP56128_P050-Biotin Conjugated

Gene Symbol:
RPL18
NCBI Gene Id:
6141
Swissprot Id:
Q07020
Protein Accession #:
NP_000970
Alias Symbols:
RPL18,
Replacement Item:
This antibody may replace item sc-131061 from Santa Cruz Biotechnology.
Description of Target:
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Size (# AA):
188
Molecular Weight:
20kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPL18.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPL18.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; FUS; HUWE1; CEP250; TP53; STAU1; MDM2; ZBTB1; RPA3; RPA2; RPA1; EED; RPLP0; RPL24; RPL23A; RPL13; IARS; FAU; NUDT21; EEF1E1; FBXO6; ICAM1; IGSF8; PAN2; ITGA4; IL7R; FN1; ESR1; CDKN1A; UBL4A; VCAM1; PA2G4; MAGOH; EIF4A3; RPS5; RPS4X; RPS3A; RPS3; RPS2
Blocking Peptide:
For anti-RPL18 (ARP56128_P050-FITC) antibody is Catalog # AAP56128
Datasheets/Manuals:
Printable datasheet for anti-RPL18 (ARP56128_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...