Search Antibody, Protein, and ELISA Kit Solutions

RPH3AL Antibody - C-terminal region : FITC (ARP73149_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73149_P050 Unconjugated

ARP73149_P050-HRP Conjugated

ARP73149_P050-Biotin Conjugated

Gene Symbol:
RPH3AL
NCBI Gene Id:
9501
Swissprot Id:
Q9UNE2
Protein Accession #:
XP_005277991
Alias Symbols:
RPH3AL, NOC2,
Replacement Item:
This antibody may replace item sc-152672 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene plays a direct regulatory role in calcium-ion-dependent exocytosis in both endocrine and exocrine cells and plays a key role in insulin secretion by pancreatic cells. This gene is likely a tumor suppressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein Size (# AA):
315
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPH3AL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPH3AL.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPH3AL
Predicted Species Reactivity:
Cow, Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: RIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
MID2; TCEA3; RIMS2; RAB3C; UNC13B; RAB3D; RAB27B; RAB27A; ZYX; RAB3B; RAB3A; RAB8A; RAB26; RAB3GAP1;
Blocking Peptide:
For anti-RPH3AL (ARP73149_P050-FITC) antibody is Catalog # AAP73149
Datasheets/Manuals:
Printable datasheet for anti-RPH3AL (ARP73149_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...