RPH3AL Antibody - C-terminal region : FITC (ARP73149_P050-FITC)

Catalog No: ARP73149_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Cow
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPH3AL
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPH3AL (ARP73149_P050-FITC) antibody is Catalog # AAP73149

Target Info

• Gene Symbol: RPH3AL
• Alias Symbols: NOC2
• NCBI Gene Id: 9501
• Description of Target: The protein encoded by this gene plays a direct regulatory role in calcium-ion-dependent exocytosis in both endocrine and exocrine cells and plays a key role in insulin secretion by pancreatic cells. This gene is likely a tumor suppressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Uniprot ID: Q9UNE2
• Protein Accession #: XP_005277991
• Protein Size (# AA): 315
• Molecular Weight: 34kDa
• Protein Interactions: MID2; TCEA3; RIMS2; RAB3C; UNC13B; RAB3D; RAB27B; RAB27A; ZYX; RAB3B; RAB3A; RAB8A; RAB26; RAB3GAP1;