Rph3a Antibody - N-terminal region (ARP59498_P050)

Catalog No: ARP59498_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-Rph3a Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Muscle

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 83%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Rabbit: 85%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Rph3a (ARP59498_P050) antibody is Catalog # AAP59498 (Previous Catalog # AAPP45595)
• Publications:

  PKN1 Directs Polarized RAB21 Vesicle Trafficking via RPH3A and Is Important for Neutrophil Adhesion and Ischemia-Reperfusion Injury. Cell Rep. 19, 2586-2597 (2017). 28636945

  Small GTPase ARF6 Is a Coincidence-Detection Code for RPH3A Polarization in Neutrophil Polarization. J Immunol. 204, 1012-1021 (2020). 31924649

• Description:
  View product citations for Rph3a Antibody - N-terminal region (ARP59498_P050) on CiteAb

Target Info

• Gene Symbol: Rph3a
• Gene Full Name: Rabphilin 3A
• Alias Symbols: AU022689, AW108370, 2900002P20Rik
• NCBI Gene Id: 19894
• Protein Name: Rabphilin-3A
• Description of Target: RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
• Uniprot ID: P47708
• Protein Accession #: NP_035416
• Nucleotide Accession #: NM_011286
• Protein Size (# AA): 681
• Molecular Weight: 75kDa
• Protein Interactions: CALM1; Rab3a; Rab27b; Rab27a; Rab8a; Rab3d; Rab3c; Rab3b;