RP2 Antibody - N-terminal region (ARP89257_P050)

Catalog No: ARP89257_P050

Host: Rabbit
Target Name: RP2
Sample Tissue: Mouse Stomach lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RP2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RP2 (ARP89257_P050) antibody is Catalog # AAP89257

Target Info

• Gene Symbol: RP2
• Gene Full Name: retinitis pigmentosa 2 homolog
• Alias Symbols: Rp, Rp2h, AI662636
• NCBI Gene Id: 19889
• Protein Name: protein XRP2
• Description of Target: Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins.
• Uniprot ID: Q9EPK2-2
• Protein Accession #: NP_001277572.1
• Nucleotide Accession #: NM_001290643.1
• Protein Size (# AA): 369
• Molecular Weight: 40 kDa