Search Antibody, Protein, and ELISA Kit Solutions

RP11-50D16.3 Antibody - middle region (ARP44638_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44638_P050-FITC Conjugated

ARP44638_P050-HRP Conjugated

ARP44638_P050-Biotin Conjugated

Gene Symbol:
NHLRC3
Official Gene Full Name:
NHL repeat containing 3
NCBI Gene Id:
387921
Protein Name:
NHL repeat-containing protein 3
Swissprot Id:
Q5JS37
Protein Accession #:
NP_001012772
Nucleotide Accession #:
NM_001012754
Alias Symbols:
DKFZp313M1221, DKFZp686E1140, LOC387921, RP11-50D16.3
Replacement Item:
This antibody may replace item sc-149962 from Santa Cruz Biotechnology.
Description of Target:
RP11-50D16.3 contains 4 NHL repeats. The function of the RP11-50D16.3 protein remains unknown.
Protein Size (# AA):
347
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RP11-50D16.3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RP11-50D16.3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RP11-50D16.3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-RP11-50D16.3 (ARP44638_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-NHLRC3 (ARP44638_P050) antibody is Catalog # AAP44638 (Previous Catalog # AAPP12110)
Datasheets/Manuals:
Printable datasheet for anti-NHLRC3 (ARP44638_P050) antibody
Target Reference:
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...