RORC Antibody - C-terminal region : FITC (ARP33244_P050-FITC)

Catalog No: ARP33244_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RORC
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RORC (ARP33244_P050-FITC) antibody is Catalog # AAP33244 (Previous Catalog # AAPS22101)
• Reference: Wang,H., et al., (2003) Mol. Genet. Metab. 79 (3), 176-182

Target Info

• Gene Symbol: RORC
• Gene Full Name: RAR-related orphan receptor C
• Alias Symbols: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
• NCBI Gene Id: 6097
• Protein Name: Nuclear receptor ROR-gamma
• Description of Target: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P51449
• Protein Accession #: NP_005051
• Nucleotide Accession #: NM_005060
• Protein Size (# AA): 518
• Molecular Weight: 58kDa
• Protein Interactions: EVI2A; NCOA6; EIF3I; CHD4; EIF4EBP1;